PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun008686
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 258aa    MW: 29776.6 Da    PI: 8.4935
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-26976PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.6e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++lvd+++++G g+W+  ++  g+ R++k+c++rw +yl
        Vun008686 14 KGPWTTEEDQKLVDYIQKHGYGNWRVLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.65.9e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
        Vun008686  67 RGRFTFEEEETIIQLHSILGNK-WSAIASRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.656961IPR017930Myb domain
SuperFamilySSF466891.91E-3211108IPR009057Homeodomain-like
SMARTSM007173.6E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-161461IPR001005SANT/Myb domain
CDDcd001672.56E-121661No hitNo description
PROSITE profilePS5129425.5362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-2765116IPR009057Homeodomain-like
SMARTSM007175.4E-1766114IPR001005SANT/Myb domain
PfamPF002493.6E-1667111IPR001005SANT/Myb domain
CDDcd001679.22E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MGRSPCCDKN GLKKGPWTTE EDQKLVDYIQ KHGYGNWRVL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF TFEEEETIIQ LHSILGNKWS AIASRLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHRPRL DLLDLSSILS SSLYGPTHMN IQRLLGTQTM VNPELLKLAS SLFSSQHREN  180
LNMCAQNCQD SFLSDPQINQ IPQHLVQTQD FAQQPCQTLD NTMNPPCSSL SMPFAQEQHL  240
VEYPSVFHDS CFQHHSQX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014507552.11e-163PREDICTED: transcription factor MYB86-like
SwissprotQ8GWP05e-72MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0L9TLU71e-163A0A0L9TLU7_PHAAN; Uncharacterized protein
TrEMBLA0A0S3QZT41e-163A0A0S3QZT4_PHAAN; Uncharacterized protein
STRINGGLYMA08G06440.11e-128(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-101MYB-like 102